docking_py package¶
Subpackages¶
Submodules¶
docking_py.cli module¶
Console script for docking_py.
-
docking_py.cli.
main
()¶ Console script for docking_py.
docking_py.docking module¶
Include the Docking class
-
class
docking_py.docking.
Docking
(name, lig_pdb=None, rec_pdb=None, lig_pdbqt=None, rec_pdbqt=None, log_level=20)¶ Bases:
object
Docking encapsulation class.
This class can be used to launch vina, smina, qvina and qvinaw.
Parameters: - name (str) – generic name of the system
- lig_pdb (str, optional) – path of the ligand coordinate file (.pdb)
- rec_pdb (str, optional) – path of the receptor coordinate file (.pdb)
- lig_pdbqt (str, optional) – path of the ligand coordinate file (.pdbqt)
- rec_pdbqt (str, optional) – path of the receptor coordinate file (.pdbqt)
- dock_pdb (str, optional) – path of the docking ligand coordinate file (.pdb)
- dock_log (str, optional) – path of the docking log file (.log)
-
align_receptor
(ref_pdb, chain_ref=['A'], chain_rec=['A'])¶ Align self.rec_pdb to ref_pdb.
Example: >>> pdb_manip.show_log() >>> TEST_OUT = str(getfixture('tmpdir')) >>> dock_4yob = Docking(name='4yob') >>> dock_4yob.extract_receptor(os.path.join(TEST_PATH, '4yob.pdb'), TEST_OUT, {'res_name': pdb_manip.PROTEIN_AA}) #doctest: +ELLIPSIS Succeed to read file ...4yob.pdb , 916 atoms found Succeed to save file ...4yob_rec.pdb >>> dock_4yob.align_receptor(os.path.join(TEST_PATH, '1hsg.pdb')) Succeed to read file .../4yob_rec.pdb , 760 atoms found Succeed to read file .../1hsg.pdb , 1686 atoms found PQITLWKRPIVTIKIGGQLKEALLNTGADDTVFEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPT ******|**|**************|*******|**||********|*******|*******| *******|********* PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT <BLANKLINE> PTNVIGRNLMTQIGCTLNF *|*|*****|********* PVNIIGRNLLTQIGCTLNF <BLANKLINE> Succeed to save file ...4yob_rec.pdb >>> coor_holo = pdb_manip.Coor(os.path.join(TEST_PATH, '1hsg.pdb')) #doctest: +ELLIPSIS Succeed to read file ...1hsg.pdb , 1686 atoms found >>> coor_rec = pdb_manip.Coor(dock_4yob.rec_pdb) #doctest: +ELLIPSIS Succeed to read file ...4yob_rec.pdb , 760 atoms found >>> rmsd = coor_rec.compute_rmsd_to(coor_holo, selec_dict={'name': ['CA'], 'chain':['A']}) >>> print('RMSD after alignement is {:.2f} Å'.format(rmsd)) RMSD after alignement is 1.50 Å
-
compute_dock_rmsd
(ref_lig_pdb, selec_dict={})¶ Compute RMSD from docking pdb to
ref_lig_pdb
. By default use all atoms for RMSD calculation. To use only Calpha atoms defineselec_dict={'name':['CA']}
.Parameters: - ref_lig_pdb (str) – PDB reference file
- selec_dict (dict, optional, default={}) – Selection for RMSD calculation
Returns: RMSD list
Return type: list
-
display
()¶ Display defined attribute of the Docking object.
-
dock_log
¶
-
dock_pdb
¶
-
dock_xml
¶
-
extract_affinity
()¶ Extract affinity from the docking
.log
file.Returns: Affinity and RMSD informations as a dictionnary Return type: dict
-
extract_autodock_pdb_affinity
(out_pdb, reorder=True)¶ Extract pdb models from the the autodock log files.
-
extract_autodock_pdb_affinity2
(out_pdb, reorder=True)¶ Extract pdb models from the the autodock log files. Makes use of the xml generated by the gpu version.
-
extract_lig_rec_pdb
(coor_in, folder_out, rec_select_dict, lig_select_dict)¶ - Extract receptor and ligand coordinates from a coor file
- remove alternative location
- Keep only amino acid residues
- Save both coordinates and add it in the object
Parameters: - pdb_id (str) – PDB ID
- rec_chain (list of str) – Chain(s) of the receptor
- lig_chain (list of str) – Chain(s) of the ligand
Object field(s) changed:
- self.rec_pdb
- self.lig_pdb
Example: >>> TEST_OUT = str(getfixture('tmpdir')) >>> dock_1hsg = Docking(name='1hsg') >>> dock_1hsg.extract_lig_rec_pdb(os.path.join(TEST_PATH, '1hsg.pdb'), TEST_OUT, {'res_name': pdb_manip.PROTEIN_AA}, {'res_name': 'MK1'}) #doctest: +ELLIPSIS Succeed to read file ...1hsg.pdb , 1686 atoms found Succeed to save file ...1hsg_rec.pdb Succeed to save file ...1hsg_input_lig.pdb >>> coor_lig = pdb_manip.Coor(dock_1hsg.lig_pdb) #doctest: +ELLIPSIS Succeed to read file ...1hsg_input_lig.pdb , 45 atoms found >>> coor_rec = pdb_manip.Coor(dock_1hsg.rec_pdb) #doctest: +ELLIPSIS Succeed to read file ...1hsg_rec.pdb , 1514 atoms found
-
extract_ligand
(coor_in, folder_out, lig_select_dict)¶ - Extract ligand coordinates
- remove alternative location
- Save coordinates and add it in the object
Object field(s) changed:
- self.lig_pdb
Example: >>> TEST_OUT = str(getfixture('tmpdir')) >>> dock_1hsg = Docking(name='1hsg') >>> dock_1hsg.extract_ligand(os.path.join(TEST_PATH, '1hsg.pdb'), TEST_OUT, {'res_name': 'MK1'}) #doctest: +ELLIPSIS Succeed to read file ...1hsg.pdb , 1686 atoms found Succeed to save file ...1hsg_lig.pdb >>> coor_lig = pdb_manip.Coor(dock_1hsg.lig_pdb) #doctest: +ELLIPSIS Succeed to read file ...1hsg_lig.pdb , 45 atoms found
-
extract_receptor
(coor_in, folder_out, rec_select_dict)¶ - Extract receptor coordinates
- remove alternative location
- Keep only amino acid residues
- align structure on ref
- Save coordinates and add it in the object
Parameters: - pdb_id (str) – PDB ID
- ref_pdb (str) – Reference coordinates file
- rec_chain (list of str) – Chain(s) of the receptor
- rec_chain – Chain(s) of the reference file
Object field(s) changed:
- self.rec_pdb
Example: >>> TEST_OUT = str(getfixture('tmpdir')) >>> dock_1hsg = Docking(name='1hsg') >>> dock_1hsg.extract_receptor(os.path.join(TEST_PATH, '1hsg.pdb'), TEST_OUT, {'res_name': pdb_manip.PROTEIN_AA}) #doctest: +ELLIPSIS Succeed to read file ...1hsg.pdb , 1686 atoms found Succeed to save file ...1hsg_rec.pdb >>> coor_rec = pdb_manip.Coor(dock_1hsg.rec_pdb) #doctest: +ELLIPSIS Succeed to read file ...1hsg_rec.pdb , 1514 atoms found
-
get_gridfld
()¶ Get
gridfld
from the.gpf
file.
-
gpf
¶
-
lig_pdb
¶
-
lig_pdbqt
¶
-
out_affinities
(fn, affinities)¶
-
prepare_grid
(out_folder, gpf_out_prefix=None, spacing=0.375, grid_npts=None, center=None, check_file_out=True)¶ Grid preparation
Launch the
prepare_gpf4.py
command from MGLToolsPackage. Andautogrid4
.
-
prepare_ligand
(lig_pdbqt=None, rigid=False, center=False, random_rot=False, check_file_out=True)¶ Ligand preparation to pdbqt format using the prepare_ligand4.py command. Can center the ligand, could be usefull with autodock (issues when x,y,z > 100 Å).
Parameters: - lig_pdbqt (str, optional, default=None) – output name
- rigid (bool, optional, default=False) – Flag to define if ligand is rigid
- center (bool, optional, default=False) – Flag to define if ligand have to centered
- check_file_out (bool, optional, default=True) – flag to check or not if file has already been created. If the file is present then the command break.
Object requirement(s):
- self.lig_pdb
Object field(s) changed:
- self.lig_pdbqt
Example: >>> TEST_OUT = str(getfixture('tmpdir')) >>> coor_1hsg = pdb_manip.Coor(os.path.join(TEST_PATH, '1hsg.pdb')) #doctest: +ELLIPSIS Succeed to read file ...tests/input/1hsg.pdb , 1686 atoms found >>> lig_coor = coor_1hsg.select_part_dict( selec_dict={'res_name': 'MK1'}) >>> lig_atom_num = lig_coor.num >>> print('Ligand has {} atoms'.format(lig_atom_num)) Ligand has 45 atoms >>> out_lig = os.path.join(TEST_OUT,'lig.pdb') >>> lig_coor.write_pdb(out_lig) #doctest: +ELLIPSIS Succeed to save file .../lig.pdb >>> test_dock = Docking('test', lig_pdb=out_lig) >>> test_dock.prepare_ligand() #doctest: +ELLIPSIS python2... .../prepare_ligand4.py -l lig.pdb -B none -A hydrogens -o lig.pdbqt >>> coor_lig = pdb_manip.Coor(test_dock.lig_pdbqt) #doctest: +ELLIPSIS Succeed to read file .../lig.pdbqt , 50 atoms found >>> test_dock.display() #doctest: +ELLIPSIS name : test lig_pdb : .../lig.pdb lig_pdbqt : .../lig.pdbqt ref_lig_pdb : .../lig.pdb
-
prepare_receptor
(rec_pdbqt=None, check_file_out=True)¶ Receptor preparation to pdbqt format using the prepare_receptor4.py command.
Parameters: - rec_pdbqt (str, optional, default=None) – output name
- check_file_out (bool, optional, default=True) – flag to check or not if file has already been created. If the file is present then the command break.
Object requirement(s):
- self.rec_pdb
Object field(s) changed:
- self.rec_pdbqt
Example: >>> TEST_OUT = str(getfixture('tmpdir')) >>> coor_1hsg = pdb_manip.Coor(os.path.join(TEST_PATH, '1hsg.pdb')) #doctest: +ELLIPSIS Succeed to read file .../1hsg.pdb , 1686 atoms found >>> # Keep only amino acid >>> rec_coor = coor_1hsg.select_part_dict(selec_dict={'res_name': pdb_manip.PROTEIN_AA}) >>> out_rec = os.path.join(TEST_OUT,'rec.pdb') >>> rec_coor.write_pdb(out_rec) #doctest: +ELLIPSIS Succeed to save file .../rec.pdb >>> rec_atom_num = rec_coor.num >>> print('Receptor has {} atoms'.format(rec_atom_num)) Receptor has 1514 atoms >>> test_dock = Docking('test', rec_pdb=out_rec) >>> test_dock.prepare_receptor() #doctest: +ELLIPSIS python2... .../prepare_receptor4.py -r .../rec.pdb -A checkhydrogens -o .../rec.pdbqt >>> coor_rec = pdb_manip.Coor(test_dock.rec_pdbqt) #doctest: +ELLIPSIS Succeed to read file .../rec.pdbqt , 1844 atoms found >>> test_dock.display() #doctest: +ELLIPSIS name : test rec_pdb : .../rec.pdb rec_pdbqt : .../rec.pdbqt
-
random_rot_ligand
()¶ - Do a random rotation on ligand
Object field(s) changed:
- self.lig_pdb
Example: >>> TEST_OUT = str(getfixture('tmpdir')) >>> dock_1hsg = Docking(name='1hsg') >>> dock_1hsg.extract_ligand(os.path.join(TEST_PATH, '1hsg.pdb'), TEST_OUT, {'res_name': 'MK1'}) #doctest: +ELLIPSIS Succeed to read file ...1hsg.pdb , 1686 atoms found Succeed to save file ...1hsg_lig.pdb >>> coor_lig = pdb_manip.Coor(dock_1hsg.lig_pdb) #doctest: +ELLIPSIS Succeed to read file ...1hsg_lig.pdb , 45 atoms found >>> com_before = coor_lig.center_of_mass() >>> dock_1hsg.random_rot_ligand() Succeed to read file ...1hsg_lig.pdb , 45 atoms found Succeed to save file ...1hsg_lig.pdb >>> coor_lig = pdb_manip.Coor(dock_1hsg.lig_pdb) #doctest: +ELLIPSIS Succeed to read file ...1hsg_lig.pdb , 45 atoms found >>> com_after = coor_lig.center_of_mass() >>> print('Same center of mass after rotation :{}'.format(com_before==com_after)) Same center of mass after rotation :[False False False]
- ..warning:
- The function overwrite lig_pdb coordinates.
-
rec_com
()¶ Get center of mass of the receptor pdb file.
-
rec_grid
(buffer_space=30, spacing=1.0)¶ Compute grid from the receptor pdb file.
-
rec_pdb
¶
-
rec_pdbqt
¶
-
ref_lig_pdb
¶
-
run_autodock
(out_folder, dock_out_prefix=None, dock_log=None, dock_pdb=None, nrun=10, check_file_out=True)¶ Run autodock with cpu or gpu if available
-
run_autodock_cpu
(out_folder, dock_out_prefix=None, dock_log=None, dock_pdb=None, dock_xml=None, dpf_out=None, nrun=10, param_list=[], check_file_out=True)¶ - Launch the
prepare_dpf4.py
command from MGLToolsPackage. - Launch
autodock4
This requires a gpf and associated map files, and ligand pdbqt It creates pose pdb + xml + dlg + dpf and smina like _log.txt files
- Launch the
-
run_autodock_docking
(out_pdb, log=None, prepare_grid=True, num_modes=100, center=None, spacing=0.375, grid_size=None, grid_max_points=None, check_file_out=True)¶ Run docking using autodock.
Parameters: - out_pdb (str) – PDB output name
- log (str, optional, default=None) – Log ouput name
- prepare_grid (bool, optional, default=True) – perform grid setup
- num_modes (int, optional, default=100) – maximum number of binding modes to generate
- center (list, optional, default=None) – coordinate of the center (x, y, z, Angstroms)
- grid_size (list, optional, default=None) – size in the docking box (x, y, z, Angstroms)
- grid_max_points (int, optional, default=None) – max number of grid points per dimension (256 for GPU)
- check_file_out (bool, optional, default=True) – flag to check or not if file has already been created. If the file is present then the command break.
Object requirement(s):
- self.lig_pdbqt
- self.rec_pdbqt
Object field(s) changed:
- self.dock_pdb
- self.dock_log
Example:
-
run_autodock_gpu
(out_folder, dock_out_prefix=None, dock_log=None, dock_pdb=None, dock_xml=None, nrun=10, check_file_out=True)¶ Autodock GPU arguments:
mandatory: -ffile ./input/1stp/derived/1stp_protein.maps.fld -lfile ./input/1stp/derived/1stp_ligand.pdbqt
opyional: -nrun # LGA runs 1 -nev # Score evaluations (max.) per LGA run 2500000 -ngen # Generations (max.) per LGA run 27000 -lsmet Local-search method sw (Solis-Wets) -lsit # Local-search iterations (max.) 300 -psize Population size 150 -mrat Mutation rate 2 (%) -crat Crossover rate 80 (%) -lsrat Local-search rate 6 (%) -trat Tournament (selection) rate 60 (%) -resnam Name for docking output log “docking” -hsym Handle symmetry in RMSD calc. 1
This requires a gpf and associated map files, and ligand pdbqt It creates pose pdb + xml + dlg and smina like _log.txt files
-
run_docking
(out_pdb, log=None, dock_bin='vina', num_modes=100, energy_range=10, exhaustiveness=16, cpu=None, seed=None, autobox=False, center=None, grid_npts=None, min_rmsd_filter=None, scoring=None, check_file_out=True)¶ Run docking using vina, qvina, qvinaw or smina.
Parameters: - out_pdb (str) – PDB output name
- log (str, optional, default=None) – Log ouput name
- dock_bin (str, optional, default='vina') – Docking software name (‘vina’, ‘qvina’, ‘qvinaw’, ‘smina’)
- num_modes (int, optional, default=100) – maximum number of binding modes to generate
- energy_range (int, optional, default=10) – maximum energy difference between the best binding mode and the worst one displayed (kcal/mol)
- exhaustiveness (int, optional, default=16) – exhaustiveness of the global search (roughly proportional to time): 1+
- cpu (int, optional, default=None) – the number of CPUs to use (the default is to try to detect the number of CPUs or, failing that, use 1)
- seed (int, optional, default=None) – explicit random seed
- autobox (bool, optional, default=False) – Flag to use ligand to define the docking box
- center (list, optional, default=None) – coordinate of the center (x, y, z, Angstroms)
- grid_npts (list, optional, default=None) – size in the docking box (x, y, z, Angstroms)
- check_file_out (bool, optional, default=True) – flag to check or not if file has already been created. If the file is present then the command break.
Object requirement(s):
- self.lig_pdbqt
- self.rec_pdbqt
Object field(s) changed:
- self.dock_pdb
- self.dock_log
Example:
-
view_dock
(ref_pdb=None)¶ Return a nglview object to view the object coordinates in a jupyter notebook with the module
nglview
.
-
docking_py.docking.
set_log_level
(level=20)¶ setup log verbose level
-
docking_py.docking.
show_log
()¶ To use only with Doctest !!! Redirect logger output to sys.stdout
Module contents¶
Top-level package for Docking Python.